PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.38667s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YC
Protein Properties Length: 131aa    MW: 15012.2 Da    PI: 8.69
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.38667s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC612.4e-196861898
                 NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                          ++++P arikki++adedv +i+  +Pvl+sk+ elf+ +l  r++  + e   +t+    ++ +v+r ++fdfl ++v +
  Araha.38667s0001.1.p  6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKSLELFLQDLCDRTYEITLERGAKTVSSLHLKHCVERYNVFDFLREVVSK 86
                          5789************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.8E-26372IPR009072Histone-fold
SuperFamilySSF471133.1E-20488IPR009072Histone-fold
PfamPF008085.1E-20871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKSLE LFLQDLCDRT YEITLERGAK  60
TVSSLHLKHC VERYNVFDFL REVVSKVPDY GHSQGQGHGD VTMDDRTISK RRKPISDEVN  120
DSDEEYKKSK T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A1e-24272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4628410.0AF462841.1 Arabidopsis thaliana At3g12480/MQC3.32 mRNA, complete cds.
GenBankAY1438470.0AY143847.1 Arabidopsis thaliana At3g12480/MQC3.32 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187854.24e-92nuclear factor Y, subunit C11
TrEMBLQ9LHG04e-92Q9LHG0_ARATH; At3g12480/MQC3.32
STRINGAT3G12480.11e-91(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35062458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.13e-95nuclear factor Y, subunit C11